Protein Info for GFF1880 in Variovorax sp. SCN45

Annotation: Previously called glutamate synthase [NADPH] small chain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 599 PF14691: Fer4_20" amino acids 17 to 99 (83 residues), 49.4 bits, see alignment E=1.5e-16 PF07992: Pyr_redox_2" amino acids 115 to 410 (296 residues), 81.5 bits, see alignment E=3e-26 PF13450: NAD_binding_8" amino acids 119 to 155 (37 residues), 23.1 bits, see alignment 3e-08 PF13738: Pyr_redox_3" amino acids 243 to 394 (152 residues), 30.4 bits, see alignment E=1e-10 PF13534: Fer4_17" amino acids 505 to 579 (75 residues), 23.5 bits, see alignment E=2.8e-08 PF12838: Fer4_7" amino acids 506 to 580 (75 residues), 42.3 bits, see alignment E=3.3e-14 PF00037: Fer4" amino acids 560 to 580 (21 residues), 27.7 bits, see alignment (E = 6.9e-10)

Best Hits

KEGG orthology group: None (inferred from 93% identity to vpe:Varpa_2455)

Predicted SEED Role

"Glutamate synthase [NADPH] small chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13

Use Curated BLAST to search for 1.4.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (599 amino acids)

>GFF1880 Previously called glutamate synthase [NADPH] small chain (Variovorax sp. SCN45)
LQRTNIADPTYFHKVVDCQYACPAHTPVPEYIRMIAQRRYGDAYMINWASNVFPGILGRT
CDRPCEPACRRGRVEESNAEAPEPVAICRLKRVAADMKDDVRARMPTAGPKNGKRVACIG
AGPASLTVARDLAPLGYEVTVFDGEAKAGGFIRTQIPRFRLPESVIDEETGYVLDLGVEF
RGGERIASMQALMAQDWDAIFVGCGAPRGRDLDVPGRQEAAAGIHIGIDWLNSVSFGHVS
SIGRRVIVLGGGNTAMDCCRSARRLGGTDVKVIVRSGFEEMKASPWEKEDAAHEGIPIIN
FHVPKAFVHEDGKLVGMRFEIVRAEYDDKGRRELVPTGEPEAYFECDEVLVAVGQENAFP
WIERDCGIDFDKWGLPVLDKNTFQSSVPNVFFGGDAAFGPKNIITAVAHGHEAAVSIDKL
LRAEPVYERPAPMTNLVSQKMGIHEWSYDNDTSNDLRYKVPWAKAEAALASIRVEVELGF
DAATAFKEAERCLNCDVQTVFTEAACIECDACVDICPMDCINFIDNAEEDELRPRLKAPA
LNLAQDLYVSGGLKTGRVMVKDEDVCLHCGLCAERCPTGAWDMQKFLLKMTPAGQGVAA