Protein Info for GFF1880 in Sphingobium sp. HT1-2

Annotation: LSU ribosomal protein L1p (L10Ae)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 TIGR01169: ribosomal protein uL1" amino acids 3 to 228 (226 residues), 330.3 bits, see alignment E=2.6e-103 PF00687: Ribosomal_L1" amino acids 31 to 220 (190 residues), 230.7 bits, see alignment E=6.3e-73

Best Hits

Swiss-Prot: 81% identical to RL1_SPHAL: 50S ribosomal protein L1 (rplA) from Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)

KEGG orthology group: K02863, large subunit ribosomal protein L1 (inferred from 96% identity to sjp:SJA_C1-27150)

MetaCyc: 53% identical to 50S ribosomal subunit protein L1 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L1p (L10Ae)" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (232 amino acids)

>GFF1880 LSU ribosomal protein L1p (L10Ae) (Sphingobium sp. HT1-2)
MAKLTKKAKALATAIDREKLHGVDEALGLIKTHATAKFDESVEIAINLGVDPRHADQMVR
GVVTLPAGTGKDVRVAVFARNDKAQQALDAGADIVGAEDLLESIQAGNIDFQRVIATPDM
MGLVGRLGKVLGPKGLMPNPKLGTVTPNVAEAVKAAKGGQIEFRVEKAGIIHAGLGKSSF
SAEDLRKNFDAFVDAIVKAKPSGSKGKYVRKIALSSSMGPGVKVDVAEVASI