Protein Info for GFF1880 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Putative threonine efflux protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 38 to 65 (28 residues), see Phobius details amino acids 72 to 92 (21 residues), see Phobius details amino acids 112 to 137 (26 residues), see Phobius details amino acids 148 to 171 (24 residues), see Phobius details amino acids 183 to 205 (23 residues), see Phobius details PF01810: LysE" amino acids 17 to 203 (187 residues), 101.2 bits, see alignment E=2.6e-33

Best Hits

KEGG orthology group: None (inferred from 62% identity to ppu:PP_2171)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (211 amino acids)

>GFF1880 Putative threonine efflux protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MFPTEILLAYVAACALVVVSPGPDNILAIGRGLSQGPLAAALSALGAGLGILFHTLAATF
GLSLIIQGSPEAFWVVKVVGALYLLWLGYKALVAGDLISFQPSARVPLRKVLLTGVLSNV
LNPKPGLFVLAFLPQFVSAGRGSVAVQMLVYGAIFALMTALIFTLMGAFASRLAGWLQAR
PRVVRGVNVGAGLTFIAAGLSVLSLKQRSAL