Protein Info for GFF1879 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: TRAP-type C4-dicarboxylate transport system, large permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 transmembrane" amino acids 6 to 38 (33 residues), see Phobius details amino acids 59 to 81 (23 residues), see Phobius details amino acids 105 to 128 (24 residues), see Phobius details amino acids 140 to 167 (28 residues), see Phobius details amino acids 176 to 198 (23 residues), see Phobius details amino acids 221 to 242 (22 residues), see Phobius details amino acids 248 to 265 (18 residues), see Phobius details amino acids 281 to 302 (22 residues), see Phobius details amino acids 314 to 334 (21 residues), see Phobius details amino acids 339 to 358 (20 residues), see Phobius details amino acids 362 to 387 (26 residues), see Phobius details amino acids 407 to 429 (23 residues), see Phobius details PF06808: DctM" amino acids 9 to 424 (416 residues), 266 bits, see alignment E=2.9e-83 TIGR00786: TRAP transporter, DctM subunit" amino acids 19 to 430 (412 residues), 281.9 bits, see alignment E=3.7e-88

Best Hits

KEGG orthology group: None (inferred from 49% identity to jan:Jann_2941)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (433 amino acids)

>GFF1879 TRAP-type C4-dicarboxylate transport system, large permease component (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSFEMWSGLIALLVLVVVGVPIVFAFAAAASLGLYFALGGIDPVINLLQQSALSGIKEYN
FVVIPCFTVMGMLIAHCGAASDLFNVVNRGLRGVPGRLAVATVGGNAVFAAVTGVGVAAA
AAFSHVAYPAMREARYSRSFATGCIAGSSVLGLLIPPSVFMIVWAILTEQSVGKLFAAGV
FPGLLLAFLYAVYCMVYAKVKPSVAPELTNEERVSLTRTQIGGSIGVGLLIAVTLGGIWF
GFFTPTEGSAIGLVGSAILAWAKGMRWRGVFNAFVEAGRTVTPIMLLLLTATIYSKLIAL
NGIPQEVQALLESMGLGTGGTLLFMVAVWFILGAMIDSISIMLLTVPIFWPVAMALGIDP
IVFALIGILVIEAGVLTPPFGIGVFVVKAAIPDRNITVSEIFKGSVPYWVLILFLAWLIY
VWPALATWLPSHI