Protein Info for GFF1878 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: TRAP-type C4-dicarboxylate transport system, small permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 169 transmembrane" amino acids 10 to 31 (22 residues), see Phobius details amino acids 44 to 64 (21 residues), see Phobius details amino acids 86 to 107 (22 residues), see Phobius details amino acids 131 to 152 (22 residues), see Phobius details PF04290: DctQ" amino acids 23 to 156 (134 residues), 83.8 bits, see alignment E=5.3e-28

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (169 amino acids)

>GFF1878 TRAP-type C4-dicarboxylate transport system, small permease component (Hydrogenophaga sp. GW460-11-11-14-LB1)
MKTWTDRALLGLHVAGAVVLVILTLVICYDVAGRLLFNKPFAGTAELAAVGLVLLTFMQA
PYVIRERKLLRVTFFLDRMPPAVRSQFNAFTYLLGAAFFIAIVIASWEPSLAGWNSGEFF
GNDAFRIPAWPLRFGSIVLWVVAALVCIGFVAEGVRGRMGQREEEQLPE