Protein Info for GFF1876 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Chemotaxis protein CheV (EC 2.7.3.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 PF01584: CheW" amino acids 23 to 163 (141 residues), 88.9 bits, see alignment E=2.4e-29 PF00072: Response_reg" amino acids 190 to 310 (121 residues), 44 bits, see alignment E=2.2e-15

Best Hits

KEGG orthology group: K03415, two-component system, chemotaxis family, response regulator CheV (inferred from 100% identity to sed:SeD_A2658)

Predicted SEED Role

"Chemotaxis protein CheV (EC 2.7.3.-)" in subsystem Bacterial Chemotaxis or Flagellar motility (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (333 amino acids)

>GFF1876 Chemotaxis protein CheV (EC 2.7.3.-) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MDNFQKDIDDRANLTLSNRFELLLFRLGTSLHEQKSELFGINVFKLREIVPMPAFTRPAG
MKAPLLGMVNIRDQVIPVIDLPAVAGCKPETGLNILLITEYARSVQAFAVESVENIMRLD
WQQVHTAEKAVNGRYITSIACLDDNKETNNLALVLDVEQILYDIVPSSHDLRATNLKTNK
FYITPGAVAIVAEDSKVARAMLEKGLNAMGIPHQMHVTGKDAWERIQQLAQEAEAEGKPI
SEKIALVLTDLEMPEMDGFTLTRKIKTDERLKKIPVVIHSSLSGSANEDHIRKVKADGYV
AKFEINELSSVIQEVLERAATNSQGPLISRKSA