Protein Info for GFF1872 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: ElaB protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 101 transmembrane" amino acids 81 to 99 (19 residues), see Phobius details PF05957: DUF883" amino acids 10 to 59 (50 residues), 35.2 bits, see alignment E=9.3e-13 PF19029: DUF883_C" amino acids 72 to 101 (30 residues), 62 bits, see alignment E=3.1e-21

Best Hits

Swiss-Prot: 89% identical to ELAB_ECO57: Protein ElaB (elaB) from Escherichia coli O157:H7

KEGG orthology group: K05594, ElaB protein (inferred from 99% identity to ses:SARI_00588)

Predicted SEED Role

"ElaB protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (101 amino acids)

>GFF1872 ElaB protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSYQFGESRVDDDLTLLSETLEEVLRSSGDPADQKYIELKARAEQALEEVKNRVSHASDS
YYYRAKQAVYKADDYVHEKPWQGIGVGAAVGLVLGLLLARR