Protein Info for GFF1871 in Variovorax sp. SCN45

Annotation: Acyl-CoA dehydrogenase, short-chain specific (EC 1.3.8.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02771: Acyl-CoA_dh_N
  • amino acids 6 to 115 (110 residues), 97.8 bits, E=1.1e-31
• PF02770: Acyl-CoA_dh_M
  • amino acids 120 to 215 (96 residues), 92.5 bits, E=3e-30
• PF00441: Acyl-CoA_dh_1
  • amino acids 230 to 375 (146 residues), 160 bits, E=9.9e-51
• PF08028: Acyl-CoA_dh_2
  • amino acids 243 to 364 (122 residues), 94.3 bits, E=1.5e-30

Best Hits

KEGG orthology group: K00257, [EC: 1.3.99.-] (inferred from 74% identity to bja:bll3299)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Brassinosteroid biosynthesis
• Caprolactam degradation
• Fatty acid metabolism
• Geraniol degradation
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.-

Use Curated BLAST to search for 1.3.99.-

Protein Sequence (380 amino acids)

>GFF1871 Acyl-CoA dehydrogenase, short-chain specific (EC 1.3.8.1) (Variovorax sp. SCN45)
MTHFLTEDQISLRDTARRFAEGEVLPRAAAIDREDKFDRVLYRGMAELGLFGVSLPEAAG
GSGFDTVSTCLVMEELARCSGAIGNAFAIPVEAALFLHHHGNESQKALIPGILDGSIVMA
TAMSEPDYGSDVASITTTARAVDDGWVLNGTKAWVTLGGVADRIMVFARTGKEAGHKSIS
CFMVDAHQAGVSRGKNEELLGMHGLEDCQIVLQDVHVPRTALIGAENEAFKTAMGNFNFS
RLLMSSMALGMAQAAMEDAVAYATTRKQFGQPIMNFQAIQFMVADMSTDIAAARLLIHHG
ARLQDAGRSIAKEGAQAKLFTTDMAMRHVSNALQIHGGNGYSRDYRIERIFRDVRLAQIY
EGTNQIQRLIISRQVEKELA