Protein Info for GFF1870 in Xanthobacter sp. DMC5

Annotation: DNA repair protein RadA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 496 TIGR00416: DNA repair protein RadA" amino acids 1 to 434 (434 residues), 553 bits, see alignment E=2.6e-170 PF18073: Zn_ribbon_LapB" amino acids 8 to 35 (28 residues), 32.3 bits, see alignment (E = 1.8e-11) PF06745: ATPase" amino acids 73 to 143 (71 residues), 40.2 bits, see alignment E=8e-14 PF13481: AAA_25" amino acids 85 to 222 (138 residues), 58.4 bits, see alignment E=2.3e-19 PF09848: SLFN-g3_helicase" amino acids 90 to 215 (126 residues), 24.8 bits, see alignment E=3.9e-09 PF13541: ChlI" amino acids 345 to 427 (83 residues), 28.2 bits, see alignment E=4.5e-10

Best Hits

Swiss-Prot: 70% identical to RADA_BRUA2: DNA repair protein RadA (radA) from Brucella abortus (strain 2308)

KEGG orthology group: K04485, DNA repair protein RadA/Sms (inferred from 88% identity to xau:Xaut_2402)

Predicted SEED Role

"DNA repair protein RadA" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (496 amino acids)

>GFF1870 DNA repair protein RadA (Xanthobacter sp. DMC5)
MARRDTSFICQSCGAVYARWQGKCEACGGWNTISEEVAVAASVPAAQRSGRKGRAVVLEK
LEGTAKPAPRLVSGIGELDRVAGGGFVPGSILLIGGDPGIGKSTLLVQASAALAQRGQRV
VYVSGEEAVDQVRLRAQRLGLEKAEVGLAAETNAENIIATLSGGPPVHMVVIDSIQTMWS
DSVESAPGTVTQVRTSAQLLVRYAKQTGACVILVGHVTKDGQIAGPRVVEHMVDAVFSFE
GDGGHQFRILRAQKNRFGPTDEIGVFEMTGRGLSEVANPSELFLSNRDAGAPGTAVFAGM
EGTRPVLVEIQALVAPSSLGTPRRAVVGWDPNRLSMVLAVLDARCGVRLGGHDVYLNVAG
GLKIGEPAADLAVAAALVSSLTGAPLPADAVHFGEASLTGAVRPVSQAQARLKEAAKLGF
ASAVIPSGGLDGLDPPVSVRPVSSLAELVAGIAASAPRRAPRETRDTAMRETRGSNDRNP
PQRAVQHADWGDDEER