Protein Info for PS417_00940 in Pseudomonas simiae WCS417

Annotation: sulfate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 transmembrane" amino acids 25 to 46 (22 residues), see Phobius details amino acids 70 to 94 (25 residues), see Phobius details amino acids 106 to 130 (25 residues), see Phobius details amino acids 146 to 166 (21 residues), see Phobius details amino acids 206 to 231 (26 residues), see Phobius details amino acids 252 to 272 (21 residues), see Phobius details TIGR02140: sulfate ABC transporter, permease protein CysW" amino acids 23 to 280 (258 residues), 396 bits, see alignment E=8.2e-123 TIGR00969: sulfate ABC transporter, permease protein" amino acids 23 to 278 (256 residues), 321.6 bits, see alignment E=4.2e-100 PF00528: BPD_transp_1" amino acids 85 to 281 (197 residues), 55 bits, see alignment E=4.4e-19

Best Hits

Swiss-Prot: 52% identical to CYSW_ECOL6: Sulfate transport system permease protein CysW (cysW) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02047, sulfate transport system permease protein (inferred from 99% identity to pfs:PFLU0189)

MetaCyc: 52% identical to sulfate/thiosulfate ABC transporter inner membrane subunit CysW (Escherichia coli K-12 substr. MG1655)
ABC-19-RXN [EC: 7.3.2.5]; ABC-7-RXN [EC: 7.3.2.5, 7.3.2.3]; 7.3.2.3 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-478 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-479 [EC: 7.3.2.5, 7.3.2.3]

Predicted SEED Role

"Sulfate transport system permease protein CysW" in subsystem Cysteine Biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.3 or 7.3.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TYG0 at UniProt or InterPro

Protein Sequence (290 amino acids)

>PS417_00940 sulfate ABC transporter permease (Pseudomonas simiae WCS417)
MSQSSISAASSANAARRGSAASRRILIGLGWLLFALFLLLPLFIVVTQGLKNGLGAFFTA
ILEPDALSALKLTVIAVVISVPLNLVFGVSAAWCVSKYSFRGKSILVTLIDLPFSVSPVI
AGLVYVLMFGAQGFFGPWLQDHDIQIVFALPGIVLATIFVTVPFVARELIPLMQEQGTQE
EEAARLLGANGWQMFWHVTVPNIKWGLIYGVVLCTARAMGEFGAVSVVSGHIRGVTNTLP
LHVEILYNEYNHVAAFAVASLLLILALFILLLKQWSENRINRLRAGAAEE