Protein Info for GFF1869 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1- carboxylate synthase (EC 4.2.99.20)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 TIGR03695: 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase" amino acids 15 to 250 (236 residues), 269.3 bits, see alignment E=1.6e-84 PF00561: Abhydrolase_1" amino acids 15 to 239 (225 residues), 62.3 bits, see alignment E=8.8e-21 PF12146: Hydrolase_4" amino acids 17 to 216 (200 residues), 29.9 bits, see alignment E=5.4e-11 PF12697: Abhydrolase_6" amino acids 17 to 244 (228 residues), 72.2 bits, see alignment E=1.5e-23

Best Hits

Swiss-Prot: 100% identical to MENH_SALTY: 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (menH) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K08680, 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase [EC: 4.2.99.20] (inferred from 100% identity to stm:STM2308)

MetaCyc: 77% identical to 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (Escherichia coli K-12 substr. MG1655)
2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase. [EC: 4.2.99.20]

Predicted SEED Role

"2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (EC 4.2.99.20)" in subsystem Menaquinone and Phylloquinone Biosynthesis (EC 4.2.99.20)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.99.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (252 amino acids)

>GFF1869 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1- carboxylate synthase (EC 4.2.99.20) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MMLHAQHMPGQPGTPSLVFLHGFSGDCHEWQPVGEQFHGCSRLYIDLPGHGGSAAIPVDG
FADVIRLLRATLISYNILKFWLVGYSLGGRVAMMAACQGIPGLCGLVVEGGHPGLQNEQA
RAERRLSDGRWAERFRHEPLTEVFHDWYQQPVFASLTAQQRQALTALRSQNNGETLAAML
EATSLAVQPDLREALNALAFPFYYLCGERDSKFRALAQEVAATCHVIRNAGHNAHRENPA
GVVDSLAQILRL