Protein Info for PS417_09490 in Pseudomonas simiae WCS417

Annotation: quinone oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 PF08240: ADH_N" amino acids 27 to 116 (90 residues), 67.8 bits, see alignment E=1.3e-22 PF00107: ADH_zinc_N" amino acids 158 to 245 (88 residues), 54.3 bits, see alignment E=2.1e-18 PF13602: ADH_zinc_N_2" amino acids 190 to 320 (131 residues), 63.1 bits, see alignment E=8.2e-21

Best Hits

KEGG orthology group: None (inferred from 73% identity to pfo:Pfl01_3909)

Predicted SEED Role

"Bifunctional protein: zinc-containing alcohol dehydrogenase; quinone oxidoreductase ( NADPH:quinone reductase) (EC 1.1.1.-); Similar to arginate lyase" (EC 1.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-

Use Curated BLAST to search for 1.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U7H6 at UniProt or InterPro

Protein Sequence (328 amino acids)

>PS417_09490 quinone oxidoreductase (Pseudomonas simiae WCS417)
MTDMHALIVDAVDAPFRLTTMPKPVAGAGQVLVRIRASGLNPLDGKIRAGQAAHARQPLP
AVLGMDLAGTVEAVGPGAGGWQVGDDVYALATGIGGAQGSLAEYAAVDARLLAKKPATLS
MREAAVLPLVLITAWEGLVDRALVGSAHKVLIQGGAGGVGHVAVQLALVYGAQVYATGSA
RHRSVIEGLGATFIDYQQQTVEAYVAQYTAGEGFDIVYDTVGGETLDASFRAAKTYHGHV
VSCLGWGQHSLAPLSFRGASYSGVFTLLPLLTAKGCEHHGQILSEAARLIDAGKLKPIMD
GHQFDLHSANAAYDLLAGGAQGRLAIEI