Protein Info for GFF1866 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: O-succinylbenzoic acid--CoA ligase (EC 6.2.1.26)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00501: AMP-binding
  • amino acids 11 to 317 (307 residues), 156.7 bits, E=7.8e-50
• TIGR01923: O-succinylbenzoate-CoA ligase
  • amino acids 29 to 445 (417 residues), 389.8 bits, E=8.1e-121
• PF13193: AMP-binding_C
  • amino acids 366 to 424 (59 residues), 34.9 bits, E=2.4e-12

Best Hits

Swiss-Prot: 100% identical to MENE_SALTY: 2-succinylbenzoate--CoA ligase (menE) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K01911, O-succinylbenzoic acid--CoA ligase [EC: 6.2.1.26] (inferred from 100% identity to see:SNSL254_A2490)

MetaCyc: 79% identical to o-succinylbenzoate--CoA ligase (Escherichia coli K-12 substr. MG1655)
o-succinylbenzoate--CoA ligase. [EC: 6.2.1.26]

Predicted SEED Role

"O-succinylbenzoic acid--CoA ligase (EC 6.2.1.26)" in subsystem Menaquinone and Phylloquinone Biosynthesis (EC 6.2.1.26)

MetaCyc Pathways

• superpathway of chorismate metabolism (54/59 steps found)
• superpathway of menaquinol-8 biosynthesis I (10/10 steps found)
• superpathway of demethylmenaquinol-8 biosynthesis I (9/9 steps found)
• 2-carboxy-1,4-naphthoquinol biosynthesis (7/7 steps found)
• superpathway of menaquinol-10 biosynthesis (9/10 steps found)
• superpathway of menaquinol-11 biosynthesis (9/10 steps found)
• superpathway of menaquinol-12 biosynthesis (9/10 steps found)
• superpathway of menaquinol-13 biosynthesis (9/10 steps found)
• superpathway of menaquinol-6 biosynthesis (9/10 steps found)
• superpathway of menaquinol-7 biosynthesis (9/10 steps found)
• superpathway of menaquinol-9 biosynthesis (9/10 steps found)
• superpathway of demethylmenaquinol-6 biosynthesis I (8/9 steps found)
• superpathway of demethylmenaquinol-9 biosynthesis (8/9 steps found)
• superpathway of phylloquinol biosynthesis (7/15 steps found)

KEGG Metabolic Maps

• Ubiquinone and menaquinone biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.2.1.26

Protein Sequence (455 amino acids)

>GFF1866 O-succinylbenzoic acid--CoA ligase (EC 6.2.1.26) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MTFTDWPWRHWRQVRSQAPALRLNDEVLSWRALCERIDVLAGGFAAQGVREGDGVLLRAG
NQPRTLLAWLALMQCGARVLPVNPQLPQTLLEALVPKLTLRFALTLEGENAFSGLTALQI
QKSTAAYAVAWQPQRLVSMTLTSGSTGLPKAAVHTCQAHLASAQGVLSLMPFGPQDDWLL
SLPLFHVSGQGIMWRWLFAGARMTVRDKQPLEQMLAGCTHASLVPTQLWRLLANRAAVTL
KAVLLGGAVIPVELTDQASKQGIRCWCGYGLTEFASTVCAKEADGSDDVGAPLPGREIRI
VDNEVWLRAASMAEGYWRDGKLIPLVNDEGWFATRDRGELNHGRLTIAGRLDNLFFSGGE
GIQPEEVERVINAHPLVQQAFVVPVEDKEFGHRPVAVVEYASQAGDVNLAEWVRDKLARF
QQPVRWLTMPSELKNGGIKISRRALQQWVCENCKN