Protein Info for GFF1864 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Polymyxin resistance protein PmrM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 125 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 43 to 64 (22 residues), see Phobius details amino acids 76 to 95 (20 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details

Best Hits

Swiss-Prot: 100% identical to ARNF_SALPB: Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF) from Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)

KEGG orthology group: K12963, undecaprenyl phosphate-alpha-L-ara4N flippase subunit ArnF (inferred from 98% identity to set:SEN2285)

MetaCyc: 69% identical to undecaprenyl-phosphate-alpha-L-Ara4N flippase - ArnF subunit (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-276

Predicted SEED Role

"Polymyxin resistance protein PmrM" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance )

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (125 amino acids)

>GFF1864 Polymyxin resistance protein PmrM (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MGVMWGLISVAIASLAQLSLGFAMMRLPSIAHPLAFISGLGAFNAATLALFAGLAGYLVS
VFCWQKTLHTLALSKAYALLSLSYVLVWVASMLLPGLQGAFSLKAMLGVLCIMAGVMLIF
LPARS