Protein Info for GFF1863 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: UDP-glucose 4-epimerase (EC 5.1.3.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04321: RmlD_sub_bind
  • amino acids 1 to 220 (220 residues), 75.4 bits, E=1.5e-24
• PF01370: Epimerase
  • amino acids 3 to 226 (224 residues), 133.2 bits, E=3.6e-42
• PF16363: GDP_Man_Dehyd
  • amino acids 4 to 306 (303 residues), 59.4 bits, E=1.5e-19
• PF13460: NAD_binding_10
  • amino acids 7 to 167 (161 residues), 47.9 bits, E=5.3e-16
• PF07993: NAD_binding_4
  • amino acids 60 to 176 (117 residues), 43.8 bits, E=6.3e-15
• PF01073: 3Beta_HSD
  • amino acids 60 to 246 (187 residues), 39 bits, E=1.7e-13

Best Hits

KEGG orthology group: None (inferred from 59% identity to tkm:TK90_1543)

MetaCyc: 59% identical to UDP-N-acetyl-alpha-D-quinovosamine dehydrogenase (Pseudomonas aeruginosa)
RXN-14767 [EC: 1.1.1.426]

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

• colanic acid building blocks biosynthesis (10/11 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (5/6 steps found)
• UDP-α-D-galactose biosynthesis (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis I (1/1 steps found)
• UDP-α-D-galactofuranose biosynthesis (1/2 steps found)
• UDP-N-acetyl-α-D-quinovosamine biosynthesis (1/2 steps found)
• D-galactose degradation I (Leloir pathway) (3/5 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (4/7 steps found)
• D-galactose detoxification (1/3 steps found)
• stachyose degradation (2/7 steps found)
• UDP-sugars interconversion (3/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)
• superpathway of UDP-N-acetylglucosamine-derived O-antigen building blocks biosynthesis (6/24 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (12/33 steps found)
• mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (1/18 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 1.1.1.426 or 5.1.3.2

Protein Sequence (314 amino acids)

>GFF1863 UDP-glucose 4-epimerase (EC 5.1.3.2) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MKVLVTGANGFVGRALCEALRRAGHEVVAGVRRPSGLPGEQILPELEDAAAWDTAAGLAC
DVVIHLAARVHVMQEQAGDPAALYRSANTTATLALARVAARAGARRLIFLSSIKVNGEHS
EPGRPFTAMDRPSPQDPYGVSKMEAEQGLHRVGSETGLEVVVVRPPLVYGPGVKANFASL
MRAVSRGLPLPLGAATDNRRSLVALDNLVDLLLTCIDHPAAAGRTFLVSDGDDLSTTDLI
RRMGRAVGRPARLLPVPTSLLHLGAALVGKKAVAQRLLGNLQVDITPTRETLGWTPPIGV
DEGLRRAAADRVQR