Protein Info for GFF1862 in Variovorax sp. SCN45

Annotation: Adenosine deaminase (EC 3.5.4.4)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 74% identical to ADE_RHOFT: Adenine deaminase (Rfer_3297) from Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)

KEGG orthology group: K01488, adenosine deaminase [EC: 3.5.4.4] (inferred from 92% identity to vap:Vapar_3887)

Predicted SEED Role

"Adenosine deaminase (EC 3.5.4.4)" in subsystem Purine conversions (EC 3.5.4.4)

MetaCyc Pathways

adenosine nucleotides degradation II (5/5 steps found)
purine nucleotides degradation II (aerobic) (9/11 steps found)
adenine and adenosine salvage III (3/4 steps found)
adenine and adenosine salvage V (2/3 steps found)
purine ribonucleosides degradation (4/6 steps found)
purine deoxyribonucleosides degradation II (1/3 steps found)
purine deoxyribonucleosides degradation I (1/4 steps found)
superpathway of purine deoxyribonucleosides degradation (3/7 steps found)

KEGG Metabolic Maps

Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.5.4.4

Use Curated BLAST to search for 3.5.4.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (353 amino acids)

>GFF1862 Adenosine deaminase (EC 3.5.4.4) (Variovorax sp. SCN45)
MTDFRPTYDQNFDRIGTDRLPELLRAMPKAELHMHIEGSLEPELIFALAQRNGVSIPYAS
VEELRRAYAFTNLQSFLDIYYAGASVLLKEQDFYDMAWAYLERAAADNVVHTEMFFDPQT
HTARGVPMETVVNGLHRACADALPKLGVSALLIMCFLRHLSEEEAFQTLEQALPYRDKFI
GVGLDSSEVGHPPEKFARVFARCRELGLHLVAHAGEEGPPAYVQSALDVLKVERVDHGVQ
SAKDPALMKRLAQDRIPLTVCPLSNLKLCVFPDLAQHNLGTLLDAGLVATVNSDDPAYFG
GYMNQNFTQTFEATGLGVRHAWQLAANSFEGSFIDEAAKRAYVDRLNAVFAAF