Protein Info for GFF1862 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Polymyxin resistance protein ArnT, undecaprenyl phosphate-alpha-L-Ara4N transferase; Melittin resistance protein PqaB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 548 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 82 to 104 (23 residues), see Phobius details amino acids 113 to 133 (21 residues), see Phobius details amino acids 139 to 154 (16 residues), see Phobius details amino acids 165 to 193 (29 residues), see Phobius details amino acids 205 to 228 (24 residues), see Phobius details amino acids 258 to 278 (21 residues), see Phobius details amino acids 289 to 307 (19 residues), see Phobius details amino acids 313 to 331 (19 residues), see Phobius details amino acids 343 to 367 (25 residues), see Phobius details amino acids 378 to 399 (22 residues), see Phobius details amino acids 405 to 424 (20 residues), see Phobius details PF02366: PMT" amino acids 5 to 238 (234 residues), 213.2 bits, see alignment E=4.6e-67 PF13231: PMT_2" amino acids 62 to 223 (162 residues), 39.9 bits, see alignment E=5.1e-14

Best Hits

Swiss-Prot: 100% identical to ARNT_SALTY: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase (arnT) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K07264, 4-amino-4-deoxy-L-arabinose transferase [EC: 2.-.-.-] (inferred from 99% identity to seg:SG2330)

MetaCyc: 71% identical to lipid IVA 4-amino-4-deoxy-L-arabinosyltransferase (Escherichia coli K-12 substr. MG1655)
RXN0-2001 [EC: 2.4.2.43]

Predicted SEED Role

"Polymyxin resistance protein ArnT, undecaprenyl phosphate-alpha-L-Ara4N transferase; Melittin resistance protein PqaB"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.- or 2.4.2.43

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (548 amino acids)

>GFF1862 Polymyxin resistance protein ArnT, undecaprenyl phosphate-alpha-L-Ara4N transferase; Melittin resistance protein PqaB (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MMKSIRYYLAFAAFIALYYVIPVNSRLLWQPDETRYAEISREMLASGDWIVPHFLGLRYF
EKPIAGYWINSLGQWLFGATNFGVRAGAILTTLLAAALVAWLTFRLWRDKRTALLASVIF
LSLFAVYSIGTYAVLDPMIALWLTAGMCCFWQGMQATTRMGKIGMFLLLGATCGLGVLTK
GFLALAVPVVSVLPWVIVQKRWKDFLLYGWLAVLSCFVVVLPWAIAIARREADFWHYFFW
VEHIQRFAMSDAQHKAPFWYYLPVLLAGSLPWLGLLPGALKLGWRERNGAFYLLGWTIMP
LLFFSIAKGKLPTYVLSCFAPIAILMARFVLHNVKEGVAALRVNGGINLVFGLVGIVAAF
VVSSWGPLKSPVWTHIETYKVFCVWGVFTVWAFVGWYSLCHSQKYLLPAFCPLGLALLFG
FSIPDRVMESKQPQFFVEMTQAPLASSRYILADNVGVAAGLAWSLKRDDIMLYGHAGELR
YGLSYPDVQDKFVKADDFNAWLNQHRQEGIITLVLSIAKDEDISALSLPPADNIDYQGRL
VLIQYRPK