Protein Info for PS417_09465 in Pseudomonas simiae WCS417

Annotation: FMN reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 84% identical to SFNF_PSEPF: NADH-dependent FMN reductase SfnF (sfnF) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K00299, FMN reductase [EC: 1.5.1.29] (inferred from 95% identity to pfs:PFLU2058)

Predicted SEED Role

"FMN reductase (EC 1.5.1.29)" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization (EC 1.5.1.29)

MetaCyc Pathways

adenosylcobalamin biosynthesis II (aerobic) (31/33 steps found)
two-component alkanesulfonate monooxygenase (2/2 steps found)
5,6-dimethylbenzimidazole biosynthesis I (aerobic) (2/3 steps found)
dibenzothiophene desulfurization (1/5 steps found)
bacterial bioluminescence (3/8 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.5.1.29

Use Curated BLAST to search for 1.5.1.29

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UIW5 at UniProt or InterPro

Protein Sequence (187 amino acids)

>PS417_09465 FMN reductase (Pseudomonas simiae WCS417)
MTRPLNVVALSGGTWRPSRTLVLTQAVLAEIATLLPIETTLIELGDIARPLGGALSRDEL
PADVEAQLLAIEQADLLIVAAPIYRGSYPGLLKHLFDLIGLNALVNTPVLLAATGGSERH
ALVLDHQLRPLFSFFQALTLPVGVYATEADFTDYQITSDLLKARIQLAAERAAPLFTAHA
PSLLKIA