Protein Info for GFF1861 in Variovorax sp. SCN45

Annotation: Transcriptional regulator, IclR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 PF09339: HTH_IclR" amino acids 27 to 76 (50 residues), 59 bits, see alignment 3.1e-20 PF01614: IclR_C" amino acids 95 to 266 (172 residues), 122.8 bits, see alignment E=1.2e-39

Best Hits

Swiss-Prot: 32% identical to PCAR_PSEPU: Pca regulon regulatory protein (pcaR) from Pseudomonas putida

KEGG orthology group: None (inferred from 74% identity to rsc:RCFBP_10048)

Predicted SEED Role

"Transcriptional regulator, IclR family" in subsystem Homogentisate pathway of aromatic compound degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (274 amino acids)

>GFF1861 Transcriptional regulator, IclR family (Variovorax sp. SCN45)
MSLYSDAMDATPDTAPEDSQSLLFNQSLEKGLAVLRAFSARRRTMTLADVAAATDITKSS
AQRMVFTLEKLGYVRKHAKTRRYQLTPRVMEIGFNYLAANSLIDVANPFLSELTKVTTET
SCLTEPDGLDMVYVARFVSAQFVPVHMPIGSRIPMYCTASGRAFLSALPEEEARALIEAS
DRTAHTMHTLTDVDGILDALRQARLQGFATNAEELFLGDMTIAAPVLGSQGRPVASVHVV
APTSRWTIDEAVRKLAPTLLLCARSLTSSARSID