Protein Info for GFF1860 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Radical SAM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 PF13489: Methyltransf_23" amino acids 91 to 240 (150 residues), 36.5 bits, see alignment E=1e-12 PF13847: Methyltransf_31" amino acids 99 to 191 (93 residues), 44 bits, see alignment E=4.9e-15 PF13649: Methyltransf_25" amino acids 103 to 190 (88 residues), 51.9 bits, see alignment E=2.5e-17 PF08242: Methyltransf_12" amino acids 104 to 191 (88 residues), 42.1 bits, see alignment E=3.1e-14 PF08241: Methyltransf_11" amino acids 104 to 191 (88 residues), 53.8 bits, see alignment E=6.5e-18

Best Hits

KEGG orthology group: None (inferred from 57% identity to rec:RHECIAT_CH0000846)

Predicted SEED Role

"Radical SAM"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (267 amino acids)

>GFF1860 Radical SAM (Hydrogenophaga sp. GW460-11-11-14-LB1)
MKAALRSLLNRFPRLKAGLKRLRSRLSPPGGVSSNYVPLKTGEAAGEAARLRDAWQSDAL
PRRQRELVNAQLAAYRRGESIDVFDVMNQALRALPSDVRGMSVLEVGCSSGFYSEVFEIA
GLGVRYAGCDYSPAFIELARQTYPDLRFDVEDATALQHDRDAFDVVISGCCLLHIPEYQA
AVAETARVARQYAVFHRTPMVLGQPNQYYRKQAYGVETVEIHFNEPEFLALLAASGLELI
ATYTLDETVHDGVGTANRTYVCRKIAP