Protein Info for GFF184 in Variovorax sp. SCN45

Annotation: Adenylate cyclase (EC 4.6.1.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 PF00211: Guanylate_cyc" amino acids 16 to 140 (125 residues), 31.9 bits, see alignment E=1e-11 PF00498: FHA" amino acids 193 to 236 (44 residues), 37.4 bits, see alignment 2.8e-13

Best Hits

KEGG orthology group: None (inferred from 94% identity to vpe:Varpa_2949)

Predicted SEED Role

"Adenylate cyclase (EC 4.6.1.1)" in subsystem cAMP signaling in bacteria (EC 4.6.1.1)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.6.1.1

Use Curated BLAST to search for 4.6.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (295 amino acids)

>GFF184 Adenylate cyclase (EC 4.6.1.1) (Variovorax sp. SCN45)
MGNARATETVTRLTQWIGGVCQAHGGRVVKSLGDGVFAIFSSGAAATHAVIELQRYHQKR
LLVWPAPLRMALQIGVASGDVVEVEGDCYGDAVNLASRLSDLAGPGQIWVTDAVISQLGE
GGVQHRDLGLINIRGRSEMSVVHRIDWQEEVTSFLTVPAALAPMRMPDSSFGQIELAWLD
VRSMFSLEQLPIHLGRVDDAQFVVNDPRVSRLHARIEVRQGSCVLIDVSTYGTWVRFHGN
GGPSTEIALRREECVLHGSGEIGLGAPLSDFSAPTISFNTTGGDVMLSRREIARR