Protein Info for GFF1838 in Variovorax sp. SCN45

Annotation: Manganese transport protein MntH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 transmembrane" amino acids 41 to 61 (21 residues), see Phobius details amino acids 82 to 105 (24 residues), see Phobius details amino acids 114 to 136 (23 residues), see Phobius details amino acids 145 to 164 (20 residues), see Phobius details amino acids 184 to 203 (20 residues), see Phobius details amino acids 239 to 262 (24 residues), see Phobius details amino acids 283 to 311 (29 residues), see Phobius details amino acids 331 to 350 (20 residues), see Phobius details amino acids 356 to 377 (22 residues), see Phobius details amino acids 395 to 415 (21 residues), see Phobius details PF01566: Nramp" amino acids 28 to 390 (363 residues), 313.5 bits, see alignment E=9.5e-98

Best Hits

KEGG orthology group: None (inferred from 94% identity to vap:Vapar_3908)

Predicted SEED Role

"Manganese transport protein MntH" in subsystem Transport of Manganese

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (417 amino acids)

>GFF1838 Manganese transport protein MntH (Variovorax sp. SCN45)
MKKRIPSFLRHVGPGVVTGAADDDPSGIATYTQAGAQFGTGLLWTVFLSLPFMVAIQLVS
ARIGRVTGKGVAANLREHMPRGFLIVLVSLLVVANTINIAADIAAMGEALQLVVGGGAHF
HSLIFGLVTVLLQVFVPYRKLAHILKWLTLTLFAYVAAVFVVQVHWAQVLHDLVVPRLQW
RGDYWMMIVALLGTTISPYLFFWQASQEVEELRLKGGRKGTDQEVRHDLKRVRLDTWMGM
TFSNLIAFFVMVVGAAVLYAAGVHDVTSAAQAAEALRPLAGDFAFWLFAGGIIATGLLAV
PVLASSAAYAVAEAFGWEEGLERHWREAKEFYGIIAVATLVGTALDFTPIDPMKALYWSA
VINGVVAVPIMAAMMILVTRENVMGVFTSGRRTRWLGWGGTALMGFAALMMGWDLVR