Protein Info for GFF1835 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Nitrate/nitrite transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 441 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 55 to 73 (19 residues), see Phobius details amino acids 85 to 103 (19 residues), see Phobius details amino acids 109 to 133 (25 residues), see Phobius details amino acids 145 to 166 (22 residues), see Phobius details amino acids 178 to 199 (22 residues), see Phobius details amino acids 247 to 269 (23 residues), see Phobius details amino acids 285 to 305 (21 residues), see Phobius details amino acids 317 to 335 (19 residues), see Phobius details amino acids 341 to 361 (21 residues), see Phobius details amino acids 370 to 389 (20 residues), see Phobius details amino acids 401 to 423 (23 residues), see Phobius details PF07690: MFS_1" amino acids 24 to 388 (365 residues), 177.2 bits, see alignment E=4.6e-56

Best Hits

KEGG orthology group: None (inferred from 100% identity to seh:SeHA_C2514)

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (441 amino acids)

>GFF1835 Nitrate/nitrite transporter (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSSPQENLYDAIRIVKRKIIPLAFILYFFNYMDRVNIGFAALRMNESLGITPEDFANISS
IFFISYLIFQIPSSIGLQKLGARKWISSIIIGWGAVTGLIFFAKDTQHILLARIFLGVFE
AGFFPGMVYYLACWFPARERGKVNSFFMLSIAVASVLAAPMSGWIIEHLNTPDYEGWRWL
FAIEGIPTVFLGILTFYLLPDSPEKAKWLTPQQISALVNKLRTDNETAAALNKNTNSSFL
SVIKNPVLLQLSFAYMLIQAAALAANYWLPGLVKGFSADFTDTDVGLIMSIPFIFAMFSM
PWWGWHSDKKNERKWHAALPMFLAGCGFLMIALVPSMSLRMLGLTFYGVGILSYYGPYWA
LPSALLSPSGLAISIAFINSCSSLGGFLINKSLGFVSTHYGATGIFIVEAILCFAAVAVL
ALMKIDVKKEKSQQTNVVSRT