Protein Info for GFF1834 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Putative dehydratase protein STM2273

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 PF02746: MR_MLE_N" amino acids 18 to 121 (104 residues), 77.6 bits, see alignment E=9.1e-26 PF13378: MR_MLE_C" amino acids 152 to 389 (238 residues), 196.2 bits, see alignment E=6e-62

Best Hits

KEGG orthology group: None (inferred from 99% identity to stt:t0591)

Predicted SEED Role

"Putative dehydratase protein STM2273"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (400 amino acids)

>GFF1834 Putative dehydratase protein STM2273 (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKITSIEVFDCELKKRDQTMSSYNPVLIRVNTDSGLSGIGEVGLAYGAGAKAGVGIIRDL
APLIVGEDPLNIEKIWEFFFRKTFWGMGGGNVFYAGMSAIDIALWDIKGKYLGVPVYQLL
GGKTNEKLRTYASQLQFGWGDKRHILVTPEEYAEAARAALDDGYDAIKVDPLEIDRNGDD
CVFQNRNRNYSGLLLADQLKMGEARIAAMREAMGDDADIIVEIHSLLGTNSAIQFAKAIE
KYRIFLYEEPIHPLNSDNMQKVSRSTTIPIATGERSYTRWGYRELLEKQSIAVAQPDLCL
CGGITEGKKICDYANIYDTTVQVHVCGGPVSTVAALHMETAIPNFIIHEHHTNAMKASIR
ELCTHDYQPENGYYVAPEQPGLGQELNDEVVKEYLAYVIK