Protein Info for GFF1833 in Sphingobium sp. HT1-2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 60 to 80 (21 residues), see Phobius details amino acids 92 to 114 (23 residues), see Phobius details amino acids 120 to 138 (19 residues), see Phobius details amino acids 181 to 199 (19 residues), see Phobius details amino acids 204 to 224 (21 residues), see Phobius details PF06912: DUF1275" amino acids 14 to 219 (206 residues), 134.2 bits, see alignment E=2.7e-43

Best Hits

KEGG orthology group: None (inferred from 75% identity to npp:PP1Y_Mpl9084)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (233 amino acids)

>GFF1833 hypothetical protein (Sphingobium sp. HT1-2)
MPPASQSASPLPGLLLLLSATTGLVDAVSVLGLGKVFTANMTGNVVFLGFAAAGTPGFRV
APYLVALLTFFIGALIAGRVGQGLGKRPLRHWLTVAALIEAALLWIAAVVALNFHVPTLP
PAAGLFAIIGLTAIAMGFRNATIRQLKVPDLTTTVLTLTVTGIAADSSLAGGANPNLGRR
IAAIVAIFAGAAAGALMVVHMGLALPLLVSGAIVLVGTLLCVRHPAAALPHGG