Protein Info for GFF1830 in Variovorax sp. SCN45

Annotation: TRAP dicarboxylate transporter, DctM subunit, unknown substrate 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 29 to 30 (2 residues), see Phobius details amino acids 60 to 80 (21 residues), see Phobius details amino acids 99 to 128 (30 residues), see Phobius details amino acids 142 to 168 (27 residues), see Phobius details amino acids 176 to 199 (24 residues), see Phobius details amino acids 224 to 262 (39 residues), see Phobius details amino acids 278 to 300 (23 residues), see Phobius details amino acids 317 to 359 (43 residues), see Phobius details amino acids 362 to 387 (26 residues), see Phobius details amino acids 403 to 428 (26 residues), see Phobius details PF06808: DctM" amino acids 11 to 422 (412 residues), 401.3 bits, see alignment E=2.4e-124 TIGR00786: TRAP transporter, DctM subunit" amino acids 22 to 429 (408 residues), 340 bits, see alignment E=8.3e-106

Best Hits

KEGG orthology group: None (inferred from 98% identity to vpe:Varpa_4527)

Predicted SEED Role

"TRAP dicarboxylate transporter, DctM subunit, unknown substrate 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (433 amino acids)

>GFF1830 TRAP dicarboxylate transporter, DctM subunit, unknown substrate 3 (Variovorax sp. SCN45)
MSPDAVAVLGFVALFVLMLLRVPVGMAMGLVGVTGYSYLVGPGPALKLVGQTSMRTVTDY
TFGVIPMFMLMGALVSVSGVSRELFKAANSMIGHLRGGLGVATVVACGGFAAICGSSVAT
AATFSAVAYPEMRRFNYPQSFSTGVIAAGGTLGAILPPSTVLAVYAILTQQDIGKLFMAG
IVPGILAMAMYVMTIAIIVKLRPDWLPGGEIKPWSERVKDLKNVWAPLVLFVFVIGGLYG
GFFTPTEAGGVGASGAFILGLVRRKLDGPKIREALLSATRTAAAVFTVLIGALLFGYFLT
ITQSPQKLTEFLTGLGIGRYGVLALIMLMYLVLGCLMDAMAMIILTVPIIYPVIVHLGFD
PIWFGVIIVMTVELGLIHPPVGMNVFVIKSVVKDVSFTTIFKGVLPFIVTDIVRLVILIA
FPIIALWLPTRMG