Protein Info for PS417_00920 in Pseudomonas simiae WCS417

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 637 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 48 to 67 (20 residues), see Phobius details amino acids 320 to 338 (19 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 81 to 205 (125 residues), 65.7 bits, see alignment E=4.5e-22 PF13188: PAS_8" amino acids 87 to 126 (40 residues), 30.3 bits, see alignment 1e-10 PF00989: PAS" amino acids 91 to 195 (105 residues), 49.4 bits, see alignment E=1.5e-16 PF08448: PAS_4" amino acids 93 to 197 (105 residues), 26.1 bits, see alignment E=3.1e-09 PF13426: PAS_9" amino acids 95 to 196 (102 residues), 61.9 bits, see alignment E=2.1e-20 PF08447: PAS_3" amino acids 106 to 191 (86 residues), 36.5 bits, see alignment E=1.7e-12 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 205 to 368 (164 residues), 129.4 bits, see alignment E=1.1e-41 PF00990: GGDEF" amino acids 209 to 365 (157 residues), 155.5 bits, see alignment E=3.8e-49 PF00563: EAL" amino acids 386 to 621 (236 residues), 259.2 bits, see alignment E=1.1e-80

Best Hits

KEGG orthology group: None (inferred from 94% identity to pfs:PFLU0185)

Predicted SEED Role

"GGDEF domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U8G5 at UniProt or InterPro

Protein Sequence (637 amino acids)

>PS417_00920 diguanylate cyclase (Pseudomonas simiae WCS417)
MPFSYRGALRAGLVYLLISVLWIGVTQRVLIEFLDNQSELNHWLQVRGYVWVTLSALAIY
LICARFARANQLQQPLKENRERLRQAAAVFDCTREGVLVTDTKGLIVHVNRAFMEITGYS
REDVMGRQPSLFKSGRHSSNFYQQMFQSLERTGEWSGEIWNRRKSGEIYPQWQTIRVIHD
DQGQVSHYVAVFSDISAIKDSEHELAHLAHHDPLTDLPNRLLFTDRAEQALASAQTHKRG
CALLLLDLDHFKIINDSLGHNVGDQLLKLVGERLKALFGPGVTLARLGGDEFAVLAESCP
QVAQAAGLAQRMLDAMKQPFIFDGHQLFISASIGISLFPSDALSAEQLLRNADSALFKAK
SAGREGYALYTEELTAHAQNRVEIASELRRALEQQELCVYYQPVHDLNDSRLIGVEALVR
WQHPERGLVPPGEFIPIAERTGLIADIDAWVMNQACRQMCDWLAQGTPLSFIAINVSSRL
FARRELYEQVAQVLHDTGLDPAFLELEVTESAVMEDPEVALEQLHRLRELGLRLAIDDFG
TGYSSLLRLKRLPVQKLKIDQGFVAGLPWDEDDAAIVRVVIALAKSMGMQVHAEGIEQRE
QARFLLDQQCDLGQGYWFGRPVPAGEIDWSKAPAIRE