Protein Info for PS417_09270 in Pseudomonas simiae WCS417

Annotation: BCCT transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 527 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 47 to 67 (21 residues), see Phobius details amino acids 88 to 107 (20 residues), see Phobius details amino acids 140 to 161 (22 residues), see Phobius details amino acids 191 to 216 (26 residues), see Phobius details amino acids 227 to 248 (22 residues), see Phobius details amino acids 260 to 281 (22 residues), see Phobius details amino acids 315 to 333 (19 residues), see Phobius details amino acids 348 to 370 (23 residues), see Phobius details amino acids 399 to 419 (21 residues), see Phobius details amino acids 449 to 468 (20 residues), see Phobius details amino acids 479 to 497 (19 residues), see Phobius details PF02028: BCCT" amino acids 9 to 498 (490 residues), 408.6 bits, see alignment E=1.6e-126

Best Hits

KEGG orthology group: None (inferred from 95% identity to pfs:PFLU2021)

Predicted SEED Role

"Glycine betaine transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U9M8 at UniProt or InterPro

Protein Sequence (527 amino acids)

>PS417_09270 BCCT transporter (Pseudomonas simiae WCS417)
MKYPLRPLVFWPTFLILLAAVIASYIDLNAFLAVSKQLNNLILKNFSWLFSAGSFAMVVL
TAIVYFSALGKVRIGGEDAQPLLSKWRWFMVALCTTLAVGVLFWTTAEPLYHLYGPPTSL
PIEAGSSAAKTFAMSTMFLHWTITPYAIYLVPSLVFALVFYNRRSNFSIGAMLEPLLGEA
RVKRYAGLIDTLAMFALVAGMASSLGTGALTLAGGLAQYIGGETTPLRLAIIIAIIVITF
VASAASGLQKGIVMLSSFNTWIMLALGLFVLLCGPTLYMFSLGVESLGVYLDTFFSRSLF
TGAASGDTWPHSWTVFYWSVWFAWAPVSALFLGKIGRGYTVREFIHINMLYPALFTAVWI
CIFSGTSLYFDALGDGSLNRVLNEQGVEHVLYQMFQQLPASGLMIAFLLFVAFISFVTAA
DSSTDVIANLCSKGVTADSDLDGNPALKIVWGVIIGSVSWVMVSFVGIDGVKMLSNLGGL
PGMLLVLLASTSLIFWLKNPALLDVKRHQRTPATELHSASPAPDFAR