Protein Info for GFF1820 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Multiple antibiotic resistance protein marC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 37 to 59 (23 residues), see Phobius details amino acids 65 to 88 (24 residues), see Phobius details amino acids 109 to 132 (24 residues), see Phobius details amino acids 138 to 162 (25 residues), see Phobius details amino acids 182 to 203 (22 residues), see Phobius details PF01914: MarC" amino acids 4 to 201 (198 residues), 168.6 bits, see alignment E=6.1e-54 TIGR00427: membrane protein, MarC family" amino acids 4 to 197 (194 residues), 161.8 bits, see alignment E=8.7e-52

Best Hits

KEGG orthology group: K05595, multiple antibiotic resistance protein (inferred from 78% identity to rfr:Rfer_3813)

Predicted SEED Role

"Multiple antibiotic resistance protein marC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (206 amino acids)

>GFF1820 Multiple antibiotic resistance protein marC (Hydrogenophaga sp. GW460-11-11-14-LB1)
MDFKPLITLLAIVNPLAIVPFFIHYTQGFSRQQRQRTVMISAFSAFAVIATCAVIGLQIL
EFFSISLASFQVGGGMLLLTSALSMLNAQPAEAKATDQELSDTSARTSIAVVPLTIPLLT
GPATMSTVVIYADQAKTFFQHAALVGYGVVIAVATAICFTLAEPIARFLGQTGINVMTRL
MGLILAALSVEVMATGLVKLFPALLG