Protein Info for GFF1815 in Variovorax sp. SCN45

Annotation: Uricase (urate oxidase) (EC 1.7.3.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 TIGR03212: putative urate catabolism protein" amino acids 10 to 313 (304 residues), 494.6 bits, see alignment E=4.2e-153 PF01522: Polysacc_deac_1" amino acids 79 to 164 (86 residues), 44.3 bits, see alignment E=8.2e-16

Best Hits

KEGG orthology group: None (inferred from 93% identity to vpe:Varpa_4540)

Predicted SEED Role

"Uricase (urate oxidase) (EC 1.7.3.3)" (EC 1.7.3.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.7.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (320 amino acids)

>GFF1815 Uricase (urate oxidase) (EC 1.7.3.3) (Variovorax sp. SCN45)
MTVYDSTLPYPRDLVGYGRNPPHARWPGGARVAVQFVLNYEEGGENATLHGDAGSEQFLS
EMFNPASFPDRHISMEGIYEYGSRAGVWRILREFEKRGLPLTVFGVGMALQRYPELTAAF
KELGHEIACHGWRWIHYQNIDEATEREHMRLGMEAIEKLTGERALGWYTGRDSPRTRRLV
ADYGGFEYDSDYYGDDLPFWMKVHKTDGSVVPQLIVPYTLDVNDMRFALPQGYSHADPFF
QYMKDTFDALYAEGDPAGDDSPKMMSIGMHCRLLGRPGRITALQRFLDHIAQHDKVWVCR
RVDIARHWKQAHPFEAGAAS