Protein Info for GFF1815 in Sphingobium sp. HT1-2

Annotation: Cytochrome O ubiquinol oxidase subunit IV (EC 1.10.3.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 138 transmembrane" amino acids 30 to 52 (23 residues), see Phobius details amino acids 62 to 82 (21 residues), see Phobius details amino acids 94 to 116 (23 residues), see Phobius details TIGR02847: cytochrome o ubiquinol oxidase subunit IV" amino acids 27 to 123 (97 residues), 103.2 bits, see alignment E=4.1e-34 PF03626: COX4_pro" amino acids 34 to 107 (74 residues), 57.6 bits, see alignment E=6.8e-20

Best Hits

KEGG orthology group: K02300, cytochrome o ubiquinol oxidase operon protein cyoD (inferred from 81% identity to sch:Sphch_1103)

Predicted SEED Role

"Cytochrome O ubiquinol oxidase subunit IV (EC 1.10.3.-)" in subsystem Terminal cytochrome O ubiquinol oxidase or Terminal cytochrome oxidases (EC 1.10.3.-)

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (138 amino acids)

>GFF1815 Cytochrome O ubiquinol oxidase subunit IV (EC 1.10.3.-) (Sphingobium sp. HT1-2)
VSDAVHSHDAHGHGHDHHDDHHEEGSHGSFGSYMIGFGLSVILTAIPFWLVMSGVLGNPQ
LTGIVIMAFAAVQVIVHMIYFLHMNTRVEGGWSFMAMMLTIVLVVIVLSGSMWVMFHLNA
NMMPHADMSAMHNMSEMP