Protein Info for PS417_09225 in Pseudomonas simiae WCS417

Annotation: C4-dicarboxylate ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 transmembrane" amino acids 27 to 47 (21 residues), see Phobius details amino acids 59 to 77 (19 residues), see Phobius details amino acids 95 to 119 (25 residues), see Phobius details amino acids 131 to 152 (22 residues), see Phobius details amino acids 164 to 187 (24 residues), see Phobius details amino acids 198 to 220 (23 residues), see Phobius details amino acids 234 to 255 (22 residues), see Phobius details amino acids 275 to 300 (26 residues), see Phobius details amino acids 310 to 330 (21 residues), see Phobius details amino acids 338 to 357 (20 residues), see Phobius details PF03595: SLAC1" amino acids 24 to 362 (339 residues), 323.5 bits, see alignment E=8.1e-101

Best Hits

KEGG orthology group: None (inferred from 96% identity to pfs:PFLU1873)

Predicted SEED Role

"C4-dicarboxylate transporter/malic acid transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See U1TGD7 at UniProt or InterPro

Protein Sequence (382 amino acids)

>PS417_09225 C4-dicarboxylate ABC transporter (Pseudomonas simiae WCS417)
MTCSNTISYKPFSHLTRPREVIRQFTPNWFAATMGTGVLALALAQLPADVPGLHAIAEAL
WFFTIGLFVLFSVLYAARWVMFFDEARRIFGHSTVSMFFGTIPMGLATILNGLLLFGLPR
WGSDVIPLAEALWWLDVAMALACGVLIPFMMFTRQEHSIDQMTAVWLLPVVAAEVAAASG
GLLAPHIADAHSQLVMLVTSYVLWAFSLPVAFSILTILMLRMALHKLPHANMAASSWLAL
GPIGTGALGMLLLGGDAPAIFAANGLPGVGEMANGLGVVAGITLWGFGLWWMLIAVLITL
RYLRAGIPFNLGWWGFTFPLGVYALATLKLASLLHLRFFSVFGSVLVVALALMWLIVAKR
TVQGAYKGELFVSPCIAGLANK