Protein Info for GFF1807 in Xanthobacter sp. DMC5

Annotation: Ornithine carbamoyltransferase, anabolic

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 TIGR00658: ornithine carbamoyltransferase" amino acids 7 to 305 (299 residues), 379.4 bits, see alignment E=5.8e-118 PF02729: OTCace_N" amino acids 7 to 148 (142 residues), 169 bits, see alignment E=7.5e-54 PF00185: OTCace" amino acids 155 to 304 (150 residues), 181.8 bits, see alignment E=9.6e-58

Best Hits

Swiss-Prot: 74% identical to OTC_RHOPA: Ornithine carbamoyltransferase (argF) from Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)

KEGG orthology group: None (inferred from 94% identity to xau:Xaut_1219)

MetaCyc: 49% identical to L-ornithine carbamoyltransferase (Sulfolobus acidocaldarius)
Ornithine carbamoyltransferase. [EC: 2.1.3.3]

Predicted SEED Role

"Ornithine carbamoyltransferase (EC 2.1.3.3)" in subsystem Arginine Biosynthesis extended or Arginine Deiminase Pathway or Arginine and Ornithine Degradation (EC 2.1.3.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (310 amino acids)

>GFF1807 Ornithine carbamoyltransferase, anabolic (Xanthobacter sp. DMC5)
MRGNGVRHFLDLSEIPAEELRRVLDFSKDLKARRKAGEPVEKPLAGKSLAMVFDKPSTRT
RVSFDLAMRQLGGETIMLTGQEMQLGRGETIADTARVLSRFVDAIMIRILDHDDLTELAK
YATVPVINGLTRISHPCQVMADVMTFEEHRGPITGRSVAWTGDANNVLASWVHAADRFDF
TLKVATPKELSPRQALKDFVKRTKAKVKFMRDPEEAVEGVDCVITDTWVSMGDKEAERRH
NILKPYQVNSALMARADKDAIFMHCLPAHRGEEVTDVVMDGPQSVVFDEAENRLHAQKGV
LAWCFDAVGG