Protein Info for GFF1804 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Sensory histidine kinase in two-component regulatory system with RstA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 117 to 132 (16 residues), see Phobius details amino acids 137 to 157 (21 residues), see Phobius details amino acids 388 to 401 (14 residues), see Phobius details PF00672: HAMP" amino acids 164 to 206 (43 residues), 34.6 bits, see alignment 2.9e-12 PF00512: HisKA" amino acids 212 to 270 (59 residues), 36.4 bits, see alignment E=6.7e-13 PF02518: HATPase_c" amino acids 318 to 423 (106 residues), 83.9 bits, see alignment E=1.6e-27

Best Hits

Swiss-Prot: 82% identical to RSTB_ECOLI: Sensor protein RstB (rstB) from Escherichia coli (strain K12)

KEGG orthology group: K07639, two-component system, OmpR family, sensor histidine kinase RstB [EC: 2.7.13.3] (inferred from 99% identity to sew:SeSA_A1570)

MetaCyc: 82% identical to sensor histidine kinase RstB (Escherichia coli K-12 substr. MG1655)
Histidine kinase. [EC: 2.7.13.3]

Predicted SEED Role

"Sensory histidine kinase in two-component regulatory system with RstA" in subsystem Orphan regulatory proteins

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (433 amino acids)

>GFF1804 Sensory histidine kinase in two-component regulatory system with RstA (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKKLFVQFYLLLFVCFLVMTLLVGLVYKFTAERAGRQSLDDLMKSSLYLMRSELREIPPR
EWGKTLKEMDLNLSFDLRVEPLNHYKLDAATTQRLREGDIVALDDQYTFIQRIPRSHYVL
AVGPVPYLYFLHQMRLLDIALMALIAFSLAFPVFIWMRPHWQEMLRLESAAQRFGEGHLT
ERLHFDNGSSFERLGVAFNQMADNINALIASKKQLIDGIAHELRTPLVRLRYRLEMSENL
TPPESQALNRDIGQLEALIEELLTYARLDRPQNELMLTEPDLPAWLLAHLQDVQSVTPER
AVNLVTCVIGDYGALDMRLMSRVLDNLLNNALRYSHTTVQVSLLLDGSQATLIVEDDGPG
IEADARERVFEPFVRLDPSRDRATGGCGLGLAIVHSIALAMGGSVVCDESELGGAKFSFR
WPVWHAMPDMTAA