Protein Info for GFF1803 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Translation elongation factor G

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 TIGR00484: translation elongation factor G" amino acids 1 to 698 (698 residues), 1204.8 bits, see alignment E=0 TIGR00231: small GTP-binding protein domain" amino acids 9 to 187 (179 residues), 108.7 bits, see alignment E=2.6e-35 PF00009: GTP_EFTU" amino acids 9 to 288 (280 residues), 207.5 bits, see alignment E=4.3e-65 PF22042: EF-G_D2" amino acids 315 to 397 (83 residues), 58.1 bits, see alignment E=2.3e-19 PF03144: GTP_EFTU_D2" amino acids 329 to 396 (68 residues), 69.9 bits, see alignment E=6.3e-23 PF14492: EFG_III" amino acids 409 to 483 (75 residues), 118.2 bits, see alignment E=3.9e-38 PF03764: EFG_IV" amino acids 484 to 604 (121 residues), 164 bits, see alignment E=3.5e-52 PF00679: EFG_C" amino acids 607 to 692 (86 residues), 103.9 bits, see alignment E=1.1e-33

Best Hits

Swiss-Prot: 91% identical to EFG_ACIAC: Elongation factor G (fusA) from Acidovorax citrulli (strain AAC00-1)

KEGG orthology group: K02355, elongation factor G (inferred from 91% identity to aav:Aave_0335)

Predicted SEED Role

"Translation elongation factor G" in subsystem Translation elongation factor G family or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (700 amino acids)

>GFF1803 Translation elongation factor G (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSRTTPLERYRNIGISAHIDAGKTTTTERILFYTGVNHKIGEVHDGAATMDWMEQEQERG
ITITSAATTCFWKGMDLSYPEHRFNIIDTPGHVDFTIEVERSMRVLDGACMVYCAVGGVQ
PQSETVWRQANKYKVPRLAFVNKMDRTGANFFKVYDQMRLRLKANPVPIVIPIGAEDNFK
GVVDLIKMKAIIWDEASQGMKFEFQDIPAELQAQAEEWREKMIEAAAESSEELMNKYLEE
GNLTEAEIKQGIRARTLATEIQPMLCGTAFKNKGVQRMLDAVIDFLPSPVDIPPVGGTDD
NEEPTSRKASDDEKLSALAFKLMTDPYVGQLTFVRVYSGVLKKGDSVFNPVKGKKERIGR
IVQMHANNRLEVEEIRAGDIAACVGLKDVTTGETLCDPDAIIMLERMVFPEPVIAQAVEP
KTKADQEKMGIALQRLASEDPSFRVKTDEESGQTIISGMGELHLEIIVDRMKREFGVEAN
VGKPQVAYRETIRKSVDEAEGKFVRQSGGKGQYGHVVFKIEPNEAGKGFEFVDAIKGGVV
PREYIPAVEKGVIEALNTGVLAGFPVVDVKVTLHFGSYHDVDSSEMAFKMAAIFGFKEGC
KKASPVILEPMMAVEVETPEDYAGNVMGDLSSRRGMVQGMEDMVGGGKAIKAEVPLSEMF
GYSTTLRSMSQGRATYTMEFKHYSEAPRNVSEAIVAARAK