Protein Info for GFF1799 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Putative inner membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 108 transmembrane" amino acids 24 to 44 (21 residues), see Phobius details amino acids 56 to 76 (21 residues), see Phobius details amino acids 82 to 105 (24 residues), see Phobius details PF06942: GlpM" amino acids 2 to 108 (107 residues), 180.6 bits, see alignment E=4.4e-58

Best Hits

Swiss-Prot: 81% identical to YDGC_ECO57: Inner membrane protein YdgC (ydgC) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 97% identity to sei:SPC_2255)

Predicted SEED Role

"Putative inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (108 amino acids)

>GFF1799 Putative inner membrane protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
VIKAALGALVVVLIGLLSKTKNYYIAGLIPLFPTFALIAHYIVASERGIDAMRTTIAFSM
WSIIPYFIYLATLWYFSGVMRLPVALGGAVVCWGLSAWLLIFCWIKWH