Protein Info for PS417_09140 in Pseudomonas simiae WCS417

Annotation: biopolymer transporter ExbB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 106 to 129 (24 residues), see Phobius details amino acids 149 to 173 (25 residues), see Phobius details PF01618: MotA_ExbB" amino acids 80 to 185 (106 residues), 93.3 bits, see alignment E=5.3e-31

Best Hits

KEGG orthology group: K03561, biopolymer transport protein ExbB (inferred from 84% identity to psp:PSPPH_0915)

Predicted SEED Role

"Ferric siderophore transport system, biopolymer transport protein ExbB" in subsystem Campylobacter Iron Metabolism or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UIQ8 at UniProt or InterPro

Protein Sequence (215 amino acids)

>PS417_09140 biopolymer transporter ExbB (Pseudomonas simiae WCS417)
MDMNLLHDITFYVMYAAMAIAIFITIERGIYFAYVRRQARALTEVLGANVHSERDLPESL
IRRDSLPLSMVLPVLAQKASQGSRKDLDDVIETQYLTTRAPLARSLWIIETITTAAPLLG
LLGTILGIIDTFKALATAGVSDPGQISGGIGTALFATGLGIAIALFCVVFHNFFQDSLER
INDQLKILLIRAATGARVQSEVPHLVPTPLHSRTA