Protein Info for GFF1796 in Methylophilus sp. DMC18

Annotation: Protein-export protein SecB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 158 PF02556: SecB" amino acids 11 to 149 (139 residues), 192.2 bits, see alignment E=2.1e-61 TIGR00809: protein-export chaperone SecB" amino acids 12 to 148 (137 residues), 178.3 bits, see alignment E=4.1e-57

Best Hits

Swiss-Prot: 63% identical to SECB_METFK: Protein-export protein SecB (secB) from Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875)

KEGG orthology group: K03071, preprotein translocase subunit SecB (inferred from 69% identity to meh:M301_0573)

Predicted SEED Role

"Protein export cytoplasm chaperone protein (SecB, maintains protein to be exported in unfolded state)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (158 amino acids)

>GFF1796 Protein-export protein SecB (Methylophilus sp. DMC18)
MAQEPQNQADQNAAPIFSIEKLYVHDASIEVPNAPAIFTERTTPQINVELGNTAQQVEDG
IFNVSIKVTVTAKIEDKTAFLVEVNQSGIFAIRNVPQENMEPILAVACPNILFPYAREAI
SDMVTRAGFMPVLLNPINFEALYLQQQQQAAQAAGAPN