Protein Info for GFF179 in Sphingobium sp. HT1-2

Annotation: 4-hydroxythreonine-4-phosphate dehydrogenase (EC 1.1.1.262)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 TIGR00557: 4-hydroxythreonine-4-phosphate dehydrogenase PdxA" amino acids 15 to 332 (318 residues), 387.5 bits, see alignment E=2.8e-120 PF04166: PdxA" amino acids 48 to 329 (282 residues), 331.2 bits, see alignment E=3e-103

Best Hits

Swiss-Prot: 60% identical to PDXA_ZYMMO: 4-hydroxythreonine-4-phosphate dehydrogenase (pdxA) from Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)

KEGG orthology group: K00097, 4-hydroxythreonine-4-phosphate dehydrogenase [EC: 1.1.1.262] (inferred from 88% identity to sjp:SJA_C1-25550)

Predicted SEED Role

"4-hydroxythreonine-4-phosphate dehydrogenase (EC 1.1.1.262)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 1.1.1.262)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.262

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (341 amino acids)

>GFF179 4-hydroxythreonine-4-phosphate dehydrogenase (EC 1.1.1.262) (Sphingobium sp. HT1-2)
MPLSNITDPVSLPPFAVSLGDPAGIGPEIVAKAWVMREARGLPTFFAVGDAASLRAVWLG
PVEIVGSPEEAAQVFERALPCMQVAEAGEIVPGTPSIDGARTAFQALEVAVGLARTGSAA
GIVTAPVGKEQLYGVGFTHPGQTEFVAERCGVSAQNAVMMLAGPSLKVVPITIHIALADV
PSALTIDLIRARALTTVKGLQRNFGIARPRLAVAGLNPHAGENGALGREEIEVIRPAIEA
LRAEGIDIVGPLAADGMFHARAREAYDAALCMYHDQALIPIKTLNFDDGVNITLGLPIVR
TSPDHGTAFGIAGTDSANPGAMIAALKMAAEAARARIAYAG