Protein Info for GFF179 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Small-conductance mechanosensitive channel

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 191 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 60 to 79 (20 residues), see Phobius details amino acids 83 to 85 (3 residues), see Phobius details amino acids 91 to 116 (26 residues), see Phobius details PF00924: MS_channel_2nd" amino acids 105 to 175 (71 residues), 27.8 bits, see alignment E=1.1e-10

Best Hits

KEGG orthology group: None (inferred from 60% identity to eba:ebA624)

Predicted SEED Role

"Small-conductance mechanosensitive channel"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (191 amino acids)

>GFF179 Small-conductance mechanosensitive channel (Hydrogenophaga sp. GW460-11-11-14-LB1)
MKDVLPAYAHPFIDVITIALQIALIVFVALLLRSLLHRLITRVGEDHRLPLELVIGGRRV
VTFLLFGAALLLVLDRVGVSGMVIWTAFTGFATVGAIAFFAAWSVLSNIFCAVLIFTSRP
FGLHDRIELLEGGDKPGLAGEVMDINLIYTTLREDTPADAEPSYLRVPNSLFFQRTTRLR
TRESVVRSLLD