Protein Info for GFF1787 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Nitrogen regulation protein NtrY (EC 2.7.3.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 762 transmembrane" amino acids 31 to 53 (23 residues), see Phobius details amino acids 66 to 91 (26 residues), see Phobius details amino acids 103 to 125 (23 residues), see Phobius details amino acids 282 to 300 (19 residues), see Phobius details amino acids 321 to 343 (23 residues), see Phobius details PF00672: HAMP" amino acids 342 to 393 (52 residues), 36.5 bits, see alignment 1.5e-12 PF13188: PAS_8" amino acids 413 to 459 (47 residues), 26 bits, see alignment 1.9e-09 PF00989: PAS" amino acids 413 to 459 (47 residues), 26.3 bits, see alignment 1.8e-09 PF08448: PAS_4" amino acids 417 to 484 (68 residues), 31.5 bits, see alignment E=5.5e-11 PF00512: HisKA" amino acids 540 to 608 (69 residues), 45.1 bits, see alignment E=2.6e-15 PF02518: HATPase_c" amino acids 649 to 750 (102 residues), 70.3 bits, see alignment E=5.6e-23

Best Hits

KEGG orthology group: None (inferred from 66% identity to pol:Bpro_4434)

Predicted SEED Role

"Nitrogen regulation protein NtrY (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (762 amino acids)

>GFF1787 Nitrogen regulation protein NtrY (EC 2.7.3.-) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSSVQGPRGQDPTMTPVHTTAPKSKPAAVRWAIGAGLVFMIGVGMVLLFLLTLATNNRAF
YEQNFTWLVGINVAVAAFLLLVILWLALRLALRLKRGKFGSRLLIKLAAIIGLVGILPGL
LIYTVSYQFVSRSIESWFDVRVESALTAGLNLGRTTLDTLTADLSSKTRVAAEGLSRVPN
PSAVLALERVREQLGVTDIVLWSASGQALGSSGSSRFDINPERPTPAQLRSARNARVVAQ
IEGLEEDGSGEIEALIAASQPRIKVLALVSPPNFGFNTESRYLQVVVPLPGALVTDALAV
QVANREYQERALTREGLRRMYIGTLTLALFLAVFGAVLLAVLLGNQLVRPLLVLAEGMRE
VAAGNLAPKTALASRDELASLTRTFAHMTQDLSDARAAVQQSMEQVDAARDNLQTILDNL
TAGVVVLDEQGRVRSVNPGAARILHTPLAVHMGQPLADVPGLEALGSGVLQQFERFLSDQ
AQHEGGHWQQSFELSADGTTPFDEGITLIARGALLPNNERLLVFDDVSEMVSAQRAKAWG
EVARRLAHEIKNPLTPIQLSAERLAMKLDGKVQPPEQAILNKSVKTIVDQVDAMKRLVNE
FRDYARLPAAQLTPVDLNALVRDIVMLYDNAAVPVRLELADGLPKALADPQQVRQTLHNL
VQNAQDAMAGVPGAQVLLRTRRSDSGQWVRLSVLDEGPGFAEHILKRAFEPYVTTKVKGT
GLGLAVVKKIMDEHGGRVDLSNRMTEGKVIGAQVSLSFAVAN