Protein Info for GFF1783 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: FIG00509904: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 64 to 83 (20 residues), see Phobius details amino acids 120 to 146 (27 residues), see Phobius details amino acids 158 to 183 (26 residues), see Phobius details amino acids 186 to 213 (28 residues), see Phobius details amino acids 233 to 254 (22 residues), see Phobius details amino acids 270 to 291 (22 residues), see Phobius details amino acids 302 to 324 (23 residues), see Phobius details amino acids 333 to 356 (24 residues), see Phobius details amino acids 362 to 384 (23 residues), see Phobius details amino acids 396 to 415 (20 residues), see Phobius details PF00654: Voltage_CLC" amino acids 74 to 414 (341 residues), 260.6 bits, see alignment E=1.2e-81

Best Hits

Swiss-Prot: 100% identical to CLCB_SALTY: Voltage-gated ClC-type chloride channel ClcB (clcB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03281, chloride channel protein, CIC family (inferred from 99% identity to seg:SG1630)

MetaCyc: 79% identical to putative chloride:H+ antiporter ClcB (Escherichia coli K-12 substr. MG1655)
RXN0-2501

Predicted SEED Role

"FIG00509904: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (429 amino acids)

>GFF1783 FIG00509904: hypothetical protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MHRLHAYPDLRAMFRRLLIATLIGILAALAVAAFRHAMQLLEWIFLSNDTGSLVNAAEGL
SPWRRLITPALGGLAAGLLLWGWQKMNQQRPHAPTDYMEALQTDGQFDVGASLVKSLASL
LVVVSGSAIGREGAMILLAALAASSFARRFTPREEWKLWIASGAAAGMAGAYHAPLAGSL
FIAEILFGTLMLASLGPVVVSAVVALLTTHVLNGSDSLLYTVHLTVDLHAREYVMIVSTG
LVAGLCGPLLMWLMTASHNSFLRLKLSPPWQLALGGLIVGLLSLLTPTVWGNGYSVVQSF
LLSPPLFSLIGGIFVCKILAVLASSGSGAPGGVFTPTLFVGLSIGMFLGRIWGFWLPGSD
EIAILLGLAGMATLLAATTHAPIMSTLMICEMTGEYQLLPGLLIACVVASVLSRTLRHDS
IYRQHAAEH