Protein Info for PS417_09040 in Pseudomonas simiae WCS417

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 353 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 31 to 51 (21 residues), see Phobius details amino acids 58 to 80 (23 residues), see Phobius details amino acids 152 to 172 (21 residues), see Phobius details amino acids 221 to 249 (29 residues), see Phobius details amino acids 269 to 290 (22 residues), see Phobius details amino acids 302 to 331 (30 residues), see Phobius details PF01594: AI-2E_transport" amino acids 11 to 339 (329 residues), 163.4 bits, see alignment E=4.5e-52

Best Hits

KEGG orthology group: None (inferred from 99% identity to pfs:PFLU1848)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TXQ6 at UniProt or InterPro

Protein Sequence (353 amino acids)

>PS417_09040 hypothetical protein (Pseudomonas simiae WCS417)
MLNNDRLLVQILLLVLFGASFWVMAPFWSALFWGAVLAFASWPLMVLLTRWLGGRESLAA
GILTLGWMLLVALPLVWLGFNLADHVRDATALIKDIQVDGLPEAPTWLGSIPFVGERLVA
MWDSIDQQGAALMVSIKPYLGQVGNWLLARSAQIGGGILELTLSLVFVFFFYRDGPRLAM
FVHRLLERLIGDRAGYYIELVAGTVQRVVNGVIGTAAAQALLALIGFLIAGVPGALVLGI
VTFLLSLIPMGPPLVWIPATAWLAWKGDYTYAVFLGVWGTFIISGVDNVLKPYLISRGGN
LPLVIVLLGVFGGLIAFGFIGLFIGPTLLAVAYSLLMDWSATHAQGRREDKPL