Protein Info for GFF1777 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Auxin Efflux Carrier

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 transmembrane" amino acids 6 to 22 (17 residues), see Phobius details amino acids 34 to 52 (19 residues), see Phobius details amino acids 64 to 84 (21 residues), see Phobius details amino acids 96 to 119 (24 residues), see Phobius details amino acids 125 to 145 (21 residues), see Phobius details amino acids 169 to 190 (22 residues), see Phobius details amino acids 199 to 219 (21 residues), see Phobius details amino acids 233 to 257 (25 residues), see Phobius details amino acids 263 to 286 (24 residues), see Phobius details amino acids 298 to 319 (22 residues), see Phobius details PF03547: Mem_trans" amino acids 9 to 313 (305 residues), 103.3 bits, see alignment E=5.3e-34

Best Hits

KEGG orthology group: K07088, (no description) (inferred from 68% identity to pol:Bpro_4280)

Predicted SEED Role

"Auxin Efflux Carrier"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (320 amino acids)

>GFF1777 Auxin Efflux Carrier (Hydrogenophaga sp. GW460-11-11-14-LB1)
VLHILLVTFPFFALVLAGYVAARRRMLPLEAIPGLNGFVLFFALPCMLYRFGSTTPIAQL
LDGWVAGLYLLCGLIVVGATIAFTRNARIRWNDASMGALVAAFPNSGFMGVPLIVALLGA
SAAGTVILTMVVDMVITSSLCIALSRLDEAQGQGRAAVAEATRKALKGVLTNPMPWAIVL
GGLASAWAFTLPKPVEQTVWLLADAASPVALFTIGAVLARAQMTANHPMPLADYLPVALM
KLFVHPLLVFAVGWLALRMGLPLSPAALTVMVLVAALPSASNVSLLAERFGADNGRIARI
ILVTTAAAFLTFSGAVALLT