Protein Info for PS417_09030 in Pseudomonas simiae WCS417

Annotation: alpha/beta hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 transmembrane" amino acids 96 to 115 (20 residues), see Phobius details PF00561: Abhydrolase_1" amino acids 29 to 151 (123 residues), 83.8 bits, see alignment E=3.1e-27 PF12146: Hydrolase_4" amino acids 30 to 125 (96 residues), 39.1 bits, see alignment E=1.1e-13 PF12697: Abhydrolase_6" amino acids 30 to 271 (242 residues), 44.4 bits, see alignment E=6.2e-15 PF00975: Thioesterase" amino acids 32 to 167 (136 residues), 32.9 bits, see alignment E=1.7e-11

Best Hits

KEGG orthology group: None (inferred from 96% identity to pfs:PFLU1846)

Predicted SEED Role

"hydrolase, alpha/beta fold family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UFF4 at UniProt or InterPro

Protein Sequence (284 amino acids)

>PS417_09030 alpha/beta hydrolase (Pseudomonas simiae WCS417)
MSTPVEEVRLSLPHIELAAHLFGPEDGLPVIALHGWLDNANSFARLAPKLQGLRVVALDM
AGHGHSAHRPTGAGYALWDYVYDVLQVAEQLGWKRFALLGHSLGAIVSLVLAGALPERVT
HLGLIDGVIPPTASGENAAERLGMALQAQLNLQEKRKPVYTTLDRAVEARMKGVVAVSRE
AAELLAQRGLMPVPGGYTWRTDSRLTLASPMRLTDEQAMAFVRRVACPTQLVVAADGMLA
KHSELLSQLPFAVSTLPGGHHLHLNEESGAVLVADCFNRFFSAP