Protein Info for GFF1773 in Methylophilus sp. DMC18

Annotation: Bifunctional riboflavin kinase/FMN adenylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 PF06574: FAD_syn" amino acids 10 to 158 (149 residues), 164.2 bits, see alignment E=3.4e-52 PF01467: CTP_transf_like" amino acids 16 to 162 (147 residues), 22.1 bits, see alignment E=2.2e-08 TIGR00083: riboflavin biosynthesis protein RibF" amino acids 16 to 294 (279 residues), 298.6 bits, see alignment E=2.6e-93 PF01687: Flavokinase" amino acids 176 to 294 (119 residues), 139 bits, see alignment E=1.5e-44

Best Hits

Swiss-Prot: 37% identical to RIBF_BUCAI: Bifunctional riboflavin kinase/FMN adenylyltransferase (ribF) from Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)

KEGG orthology group: K11753, riboflavin kinase / FMN adenylyltransferase [EC: 2.7.1.26 2.7.7.2] (inferred from 68% identity to meh:M301_0538)

Predicted SEED Role

"Riboflavin kinase (EC 2.7.1.26) / FMN adenylyltransferase (EC 2.7.7.2)" in subsystem Riboflavin, FMN and FAD metabolism (EC 2.7.1.26, EC 2.7.7.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.26 or 2.7.7.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (300 amino acids)

>GFF1773 Bifunctional riboflavin kinase/FMN adenylyltransferase (Methylophilus sp. DMC18)
MQIFRHFPAAQTPQAIAIGNFDGMHLGHQALLRQLIAYTQTYKITPAVMTFEPHPREFFT
PQNAPARLASMREKLEYFAECGVQHVYVQRFNQAFAGQSPTAFMQVLREQLNANVVMVGE
DFCFGSRRAGSVQTLIEHGFNVIPLPEVQLQGERVSSTLVRDALAAGELLKAQALLGRPY
SISGKVVHGAKLGRQLGFPTANVHMRHERPALTGVYAVKLNNLPAVANLGNRPTLEGIPK
LKLEVHVFDFNGDLYGQHVHVQFFHKLRDEQKFAGLDALKAQIALDTAAAKSYFATDKRR