Protein Info for GFF1767 in Xanthobacter sp. DMC5

Annotation: Signal recognition particle receptor FtsY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 PF02881: SRP54_N" amino acids 152 to 215 (64 residues), 40.7 bits, see alignment E=4.5e-14 TIGR00064: signal recognition particle-docking protein FtsY" amino acids 166 to 434 (269 residues), 325.1 bits, see alignment E=1.7e-101 PF06414: Zeta_toxin" amino acids 232 to 340 (109 residues), 23 bits, see alignment E=9.6e-09 PF13604: AAA_30" amino acids 236 to 336 (101 residues), 31.1 bits, see alignment E=3.9e-11 PF00448: SRP54" amino acids 236 to 434 (199 residues), 237.1 bits, see alignment E=2.7e-74

Best Hits

KEGG orthology group: K03110, fused signal recognition particle receptor (inferred from 60% identity to mno:Mnod_4411)

Predicted SEED Role

"Signal recognition particle receptor protein FtsY (=alpha subunit) (TC 3.A.5.1.1)" in subsystem Bacterial Cell Division or Two cell division clusters relating to chromosome partitioning or Universal GTPases (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (438 amino acids)

>GFF1767 Signal recognition particle receptor FtsY (Xanthobacter sp. DMC5)
MSQQDGGNDKKKRGFWGWLKGEPAAETPVAPEPAPSDVAPEAPAPAPVESVAAEAAEVPA
PEPVAPEPVAAIEEQPVAEAEPEPVAEVTPEPVEVPQPVEAPAPEPTPALAAEAPPPDLP
PPAEEPAAPAPEPRKGFWSRLASGLARTASSLGQGITDLVSKRKLDAATLEELEEVLIRA
DLGVETSMRIVEDVGRGRHDKMISAEEVKSLIAAEVERILAPVATPLVVDTAHKPFILLM
VGVNGSGKTTTIGKLASQWRAEGRKVVLAAGDTFRAAAIEQLKVWGQRTGATVIAREQGA
DAAGVAHDAITEARAQNADILMIDTAGRLQNRAELMAELEKVVRVIKKQEPTAPHAVLLV
LDATVGQNALSQVEAFARIAGVTGLVMTKLDGTARGGILVAIAAKHKLPIHLIGVGEGQD
DLQPFAARDFARAIAGLE