Protein Info for GFF1767 in Pseudomonas sp. DMC3

Annotation: Arylesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 PF00561: Abhydrolase_1" amino acids 21 to 256 (236 residues), 128.2 bits, see alignment E=1.1e-40 PF12146: Hydrolase_4" amino acids 23 to 122 (100 residues), 49.5 bits, see alignment E=9.2e-17 PF12697: Abhydrolase_6" amino acids 23 to 263 (241 residues), 85 bits, see alignment E=3.1e-27 PF01738: DLH" amino acids 207 to 260 (54 residues), 23.1 bits, see alignment E=1.3e-08

Best Hits

Swiss-Prot: 85% identical to ESTE_PSEFL: Arylesterase from Pseudomonas fluorescens

KEGG orthology group: None (inferred from 96% identity to pfo:Pfl01_3265)

Predicted SEED Role

"Alpha/beta hydrolase fold (EC 3.8.1.5)" (EC 3.8.1.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.8.1.5

Use Curated BLAST to search for 3.8.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (272 amino acids)

>GFF1767 Arylesterase (Pseudomonas sp. DMC3)
MSTFKTQDGTEIYYKDWGSGKPVLFSHGWPLDADMWEYQMEYLSSRGYRTIAFDRRGFGR
SDQPWTGYDYDTFADDIAGLINHLDLHDVTLVGFSMGGGDVSRYIARHGSERVAGLVLLG
AVTPLFGKKADFADGVDKSVFDGIKAGLLKDRAQFIADFNAPFYGTNQGQKVSDGVLTQT
LNIALLASLKGTVDCVTAFSETDFRPDMAKIDVPTLVIHGDGDQIVPFETTGKQAAAQIK
GAELKVYAGAPHGFAVTHAQALNEDLLAFLNR