Protein Info for GFF1766 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: D-galactonate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 transmembrane" amino acids 17 to 36 (20 residues), see Phobius details amino acids 55 to 77 (23 residues), see Phobius details amino acids 84 to 111 (28 residues), see Phobius details amino acids 144 to 165 (22 residues), see Phobius details amino acids 171 to 190 (20 residues), see Phobius details amino acids 245 to 265 (21 residues), see Phobius details amino acids 281 to 302 (22 residues), see Phobius details amino acids 314 to 335 (22 residues), see Phobius details amino acids 341 to 363 (23 residues), see Phobius details amino acids 373 to 397 (25 residues), see Phobius details amino acids 404 to 425 (22 residues), see Phobius details PF07690: MFS_1" amino acids 23 to 391 (369 residues), 201.3 bits, see alignment E=2.2e-63 TIGR00881: phosphoglycerate transporter family protein" amino acids 24 to 407 (384 residues), 412.6 bits, see alignment E=1.5e-127 TIGR00893: D-galactonate transporter" amino acids 25 to 425 (401 residues), 478.5 bits, see alignment E=1.7e-147 PF00083: Sugar_tr" amino acids 51 to 424 (374 residues), 35.4 bits, see alignment E=6e-13

Best Hits

Swiss-Prot: 91% identical to DGOT_ECOL6: D-galactonate transporter (dgoT) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K08194, MFS transporter, ACS family, D-galactonate transporter (inferred from 99% identity to seg:SG3605)

MetaCyc: 91% identical to D-galactonate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-16

Predicted SEED Role

"D-galactonate transporter" in subsystem D-galactonate catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (432 amino acids)

>GFF1766 D-galactonate transporter (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MTMDISVTAAQPGRRRYLTLVMIFITVVICYVDRANLAVASMHIQKEFGITKAEMGYVFS
AFAWLYTLCQIPGGWFLDRIGSRLTYFIAIFGWSVATLLQGFATGLLSLIGLRAITGIFE
APAFPANNRMVTSWFPEHERASAVGFYTSGQFVGLAFLTPLLIWIQEMLSWHWVFIVTGG
IGIIWSLVWFKVYQPPRLTKSLSQAELEYIRDGGGLVDGDAPAKKEARQPLTKADWKLVF
HRKLVGVYLGQFAVNSTLWFFLTWFPNYLTQEKGITALKAGFMTTVPFLAAFFGVLLSGW
LADKLVKKGFSLGVARKTPIICGLLISTCIMGANYTNDPLWIMALMAIAFFGNGFASITW
SLISSLAPMRLIGLTGGMFNFIGGLGGISVPLVIGYLAQSYGFAPALVYISVVALLGALS
YILLVGDVKRVG