Protein Info for GFF1765 in Variovorax sp. SCN45

Annotation: putative membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 200 to 221 (22 residues), see Phobius details amino acids 241 to 261 (21 residues), see Phobius details amino acids 270 to 288 (19 residues), see Phobius details amino acids 297 to 315 (19 residues), see Phobius details amino acids 330 to 353 (24 residues), see Phobius details amino acids 362 to 380 (19 residues), see Phobius details PF13795: HupE_UreJ_2" amino acids 194 to 355 (162 residues), 161.4 bits, see alignment E=6.9e-52

Best Hits

KEGG orthology group: None (inferred from 74% identity to vpe:Varpa_4604)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (392 amino acids)

>GFF1765 putative membrane protein (Variovorax sp. SCN45)
MQRLERAALAALAMLMLLALLFGAAPAHAHKASDAYLQLKRTGDTIDLRWDIALRDLDAM
LDLDSNADRKLSWGEVRTRLADIRAYALARLRLQQGQCVLAEAQAPAVEDRIDGAYLVLR
LQAPCKAGAALDIDYRLFREVDPTHRGLLRMEAEGGAQPTVRSLDPSAGPVSVPWPGSDV
AASADAARQADGSFFRDGIHHILIGYDHILFLICLLLPAVLRRREGGWEPVLGWREAVWP
MLGIVTMFTIAHSITLALAGLKIVTISPRIIEPGIAITIMLAAIDNIHPVLRGRRKLFSF
LFGLIHGFGFAGALAELDLPLRDFVIALLQFNLGVEAGQLMVVAVVLVALLALRNWQRYP
PLVLRGGSALAVLLAAIWLGERVFDIKVLPFS